Sign In | Join Free | My hardware-wholesale.com
hardware-wholesale.com
Products
Search by Category
Home > Food & Beverage > Seafood > Fish >

Salmon Net

1-10 Results for

salmon net

from 500 Products

160g canned salmon in oil with boneless and skinless

China 160g canned salmon in oil with boneless and skinless on sale
...160g canned salmon in oil with boneless and skinless Brands: in buyers' option Block: chunk Packing: 160g/dw112g ......
Tropical Food Manufacturing(Ningbo) Co., Ltd.

Address: RM1809,A zone, 95Int`l Mansion, Yang Mu Qi Road, Ningbo, China.

Australia nylon Netting 100-500mesh Nylon Mesh For AQUACULTURE CAGES & NETS

China Australia nylon Netting 100-500mesh Nylon Mesh For AQUACULTURE CAGES & NETS on sale
...50micron and 1000micron Monofilament Nylon Aquaculture Plastic netting For Aquaculture: Aquaculture Plastic netting from Industrial Netting has many characteristics 1.Chemical resistance 2. Can be used in a widely temperature range 3. Easy to make 4. ......
Shijiazhuang Gezi Screen Mesh Co., ltd

Address: Room A- 519, Hongsheng Business Plaza, Yuhua District, Shijiazhuang, Hebei, China

Frozen chum salmon fillets

China Frozen chum salmon fillets on sale
Frozen chum salmon fillet, portions 11-13, 13+ Chum salmon (Oncorhynchus Keta) FAO 67 Purse Seine FAO 61 set net...
QINGDAO TRUSTMEI INTERNATIONAL CO., LTD.

Address: Qingdao, Chna; Contact Person : Mr. Leo Lee ; Business Phone : 13791967463; Skype : leolee7777; Email : trustmei@126.com

Safe Custom Cold Smoke Generator Round Shape For Salmon Meat Burn Cooking

China Safe Custom Cold Smoke Generator Round Shape For Salmon Meat Burn Cooking on sale
...Safe Cold Smoke Generator for Salmon Meat Burn Cooking Why more and more customers choose our cold smoke generator? ----------- Good features ......
Anping Shuxin Wire Mesh Manufactory Co., Ltd.

Address: Yantuan Industrial Zone, Anping County, Hengshui City, Hebei Province, China

Small Fresh Processing Machine Squid Skin Peeler Salmon Peeling

China Small Fresh Processing Machine Squid Skin Peeler Salmon Peeling on sale
Small Fresh Processing Machine Squid Skin Peeler Brief introduction Automatic small type fish skinning machine can skin different kinds of fishes such as sleeve-fish, Tilapia mossambica, catfish, gadus, flatfish, snapper, bream, etc.The Skinner ......
Guangzhou Jiuying Food Machinery Co.,Ltd

Address: Room 129A, Yangming International Building, No.180 , Tianyuan Area GuangZhou

Peptide synthesis API powder Calcitonin Acetate(Salmon) CAS 47931-85-1

China Peptide synthesis  API powder Calcitonin Acetate(Salmon) CAS 47931-85-1 on sale
...Calcitonin Acetate(Salmon) Cas No: 47931-85-1(net) Formula: C145H240N44O48S2 Molecular: 3431.85 Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP Purity:98% Appearance: white powder Source: synthetic Also ......
Chengdu youngshe chemical Co,.Ltd

Pacific Chum Salmon Fillet

China Pacific Chum Salmon Fillet on sale
...'s pacaging Chemical free and 100% net weight. Alaska cold water chum salmon MSC certified IVP/IWP, fatline remved,trim C-D-E. pine bone ou. 10 years expeiences in chum salmon pocessig. Better price and better......
Dalian Baolong Aquatic Foods Co.,Ltd

Phone: 86-0411-87840516

Address: MAJIA INDUSTRIAL ZONE,JINZHOU DIST., DALIAN, CHINA Dalian Liaoning Dalian Liaoning 116100 China

12V Squid Green LED Fishing Lights Underwater Fish Lure Salmon Growth Lamp

China 12V Squid Green LED Fishing Lights Underwater Fish Lure Salmon Growth Lamp on sale
...12V Squid Green LED Fishing Lights Underwater Fish Lure Salmon Growth Lamp Description: We adopt anticorrosion 316 stainless steel to make the heat sink for ......
Wuhan ZJKC Technology Co., Ltd.

Address: Building 1 , No . 2 of Caifu 1st Road , east lake development zone , Wuhan 430074 , Hubei PRC , CN .

Fish Farming Net

China Fish Farming Net on sale
... x 24M Common farming purpose Salmon cage net Tuna cage net Cod cage net Sea-Bream cage net Trout cage net Cobia cage net Abalone cage net Sea lion fencing net Bird Protection net Speciality Our cage nets are made from high......
KING CHOU MARINE TECHNOLOGY CO., ltd

Phone: +886-7-5352937

Make Cheap Salmon Fishing Nets Supplier

China Make Cheap Salmon Fishing Nets Supplier on sale
...Home nylon monofilament fishing net Make Cheap Salmon Fishing Nets Supplier Make Cheap Salmon Fishing Nets Supplier 1. Add Japan imported resins, the knot is fixed. Free Sample. 2. You can custom any ......
ChaoHu Running Water Fishing Net & Tackle Co.,Ltd

Phone: 008613856522702

Submit your salmon net inquiry in a minute :
*From:
Your email address is incorrect!
To:

ChaoHu Running Water Fishing Net & Tackle Co.,Ltd

Products: Make Cheap Salmon Fishing Nets Supplier

*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
 
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want everychina.com to recommend me more suppliers.
Submit salmon net inquiry
*From:
Your email address is incorrect!
*Subject:
Your subject must be between 10-255 characters!
*Message:
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0

Home| Products| Suppliers| Quality Suppliers| Site Map |About Us |Contact Us |Help |关于我们 |联系我们

Copyright © 2009 - 2019 hardware-wholesale.com. All rights reserved.